PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KN539850.1_FGP002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRAS
Protein Properties Length: 434aa    MW: 47922.4 Da    PI: 10.3114
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KN539850.1_FGP002genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS95.58e-304213641140
               GRAS  41 laayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaL 132
                        +a+yf+eAL+  l+     + +a +ps++++++++ +l+a+k+fsevsP+l+f+hlt+ qa+l+++ g+ ++H++Dfdi++G QW++L+q+L
  KN539850.1_FGP002  42 AAFYFKEALRLALSP----TGDAPAPSASTPYDVVVKLSAYKAFSEVSPVLQFAHLTCVQAVLDELGGAGCIHVLDFDIGMGEQWASLMQEL 129
                        79***********99....999999******************************************************************* PP

               GRAS 133 asRpegpp 140
                        a+R+ +++
  KN539850.1_FGP002 130 AQRR-PAA 136
                        *995.333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098515.8521140IPR005202Transcription factor GRAS
PfamPF035142.8E-2742136IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MPFGGSAREG HAGTLLQQHL IHGVGLAAGG KLVSSSASGA GAAFYFKEAL RLALSPTGDA  60
PAPSASTPYD VVVKLSAYKA FSEVSPVLQF AHLTCVQAVL DELGGAGCIH VLDFDIGMGE  120
QWASLMQELA QRRPAAALKM QSAMSQWCCT ALLSKKERKR WNVHLVIVLV LLPLPVLEMQ  180
RKGGNHGVKR PCFTEMAAKH LRVNLLTTLT GPRAPPTPAQ HRTGTSRTAA ATLDGYTTLT  240
WDSAPKWPWH RMHKPDRLRW AHWGVTGEPQ CAAGAVAIGQ ASGHTGVRDT AGANWQETCI  300
VVTEMDVKLA DKFRKKWYHS SKLQKRRCTV GLIKQDLKVQ NQGGESEASR HKGLQISFRQ  360
VQISLRKPNR KCKHSGQTVK LINENCYYLS TKRNNLKMKE VNYRCYIYAE ELHPLKVMFR  420
NTQAKICQID VQKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126181e-155CP012618.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 10 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLQ7XCD70.0Q7XCD7_ORYSJ; GRAS family transcription factor containing protein, expressed
STRINGLOC_Os10g40390.11e-180(Oryza sativa Japonica Group)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.15e-23GRAS family protein